(data stored in ACNUC7421 zone)

EMBL: BA000007.YAAX

BA000007.YAAX        Location/Qualifiers
FT   CDS             5251..5547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="ECs_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33428"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33428"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA78"
FT                   /protein_id="BAB33428.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMATQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAHHDHHGGHGPGKHHR"
     MKKMQSIVLA LSLVLVAPMA TQAAEITLVP SVKLQIGDRD NRGYYWDGGH WRDHGWWKQH        60
     YEWRGNRWHP HGPPPPPRHH KKAHHDHHGG HGPGKHHR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page