(data stored in ACNUC7421 zone)

EMBL: BA000007.YABI

BA000007.YABI        Location/Qualifiers
FT   CDS             76198..76962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="ECs_0069"
FT                   /product="DedA family inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33492"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33492"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA07"
FT                   /protein_id="BAB33492.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLVRHPLMPVYIDILRKVVGV"
     MQALLEHFIT QSTVYSLMAV VLVAFLESLA LVGLILPGTV LMAGLGALIG SGELSFWHAW        60
     LAGIVGCLLG DWISFWLGWR FKKPLHRWSF LKKNKALLDK TEHALHQHSM FTILVGRFVG       120
     PTRPLVPMVA GMLDLPVAKF ITPNIIGCLL WPPFYFLPGI LAGAAIDIPA GMQSGEFKWL       180
     LLATAVFLWV GGWLCWRLWR SGKATDRLSH YLSRGRLLWL TPLISAIGVV ALVVLVRHPL       240
     MPVYIDILRK VVGV                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page