(data stored in ACNUC7421 zone)

EMBL: BA000007.YACC

BA000007.YACC        Location/Qualifiers
FT   CDS             complement(140943..141251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="ECs_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33549"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33549"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X949"
FT                   /protein_id="BAB33549.2"
FT                   /translation="MAVCANSYALSESEAEDMADLTAVFVFLKNDCGYQNLPNGQIRRA
FT                   LVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALARDSLSLLAYVK"
     MAVCANSYAL SESEAEDMAD LTAVFVFLKN DCGYQNLPNG QIRRALVFFA QQNQWDLSNY        60
     DTFDMKALGE DSYRDLSGIG IPVAKKCKAL ARDSLSLLAY VK                          102
//

If you have problems or comments...

PBIL Back to PBIL home page