(data stored in ACNUC7421 zone)

EMBL: BA000007.YACH

BA000007.YACH        Location/Qualifiers
FT   CDS             complement(133780..135633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECs_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33544"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33544"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X959"
FT                   /protein_id="BAB33544.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASAGLYIKSRTVEAPVETQSTQL
FT                   AVSDAAAVTLPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDALLSQVLMASTYPT
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKTVPVTQTVTAPVIPSNTVST
FT                   ANPVITEPATTVISIEPGNPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFVDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDNYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAEHYGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVHEKMQTNPQNQQRREAARERIQPASPEQRQAVREKMQTN
FT                   PQIQQRRDAARERIQSASPEQRQVFKEKVQQRPLNQQQRDNARQRVQSASPEQRQVFRE
FT                   KVQESRPQRLNDSNHTARLNNEQRSAVRERLSERGARRLER"
     MKMTLPFKPH VLALICSAGL CAASAGLYIK SRTVEAPVET QSTQLAVSDA AAVTLPATVS        60
     APPVTPAVVK SAFSTAQIDQ WVAPVALYPD ALLSQVLMAS TYPTNVAQAV QWSHDNPLKQ       120
     GDAAIQAVSD QPWDASVKSL VAFPQLMALM GENPQWVQNL GDAFLAQPQD VMDSVQRLRQ       180
     LAQQTGSLKS STEQKVITTT KKTVPVTQTV TAPVIPSNTV STANPVITEP ATTVISIEPG       240
     NPDVVYIPNY NPTVVYGNWA NTAYPPVYLP PPAGEPFVDS FVRGFGYSMG VATTYALFSS       300
     IDWDDDDHDH HHHDDDNYHH HDGGHRDGNG WQHNGDNINI DVNNFNRITG EHLTDKNMAW       360
     RHNPNYRNGV PYHDQDMAKR FHQTDVNGGM SATQLPAPTR DSQRQAAASQ FQQRTHAAPV       420
     ITRDTQRQAA AQRFNEAEHY GSYDDFRDFS RRQPLTQQQK DAARQRYQSA SPEQRQAVHE       480
     KMQTNPQNQQ RREAARERIQ PASPEQRQAV REKMQTNPQI QQRRDAARER IQSASPEQRQ       540
     VFKEKVQQRP LNQQQRDNAR QRVQSASPEQ RQVFREKVQE SRPQRLNDSN HTARLNNEQR       600
     SAVRERLSER GARRLER                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page