(data stored in ACNUC7421 zone)

EMBL: BA000007.YADC

BA000007.YADC        Location/Qualifiers
FT   CDS             complement(154328..155437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadC"
FT                   /locus_tag="ECs_0139"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33562"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33562"
FT                   /db_xref="GOA:Q8X928"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR017014"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X928"
FT                   /protein_id="BAB33562.1"
FT                   /translation="MQRKGNKLLIQLCSVILLFFTTSWYALANECYIERNAEGDYHMKI
FT                   SSTQLSLASQMVEVPTEIAEATWDVNIQLRGDAIGCKSLGDSKAVHFLNTADPSLISTY
FT                   TTTNGAALLKTTVPGIVYSVELLCLSCGAADELDLWLPAQSGADNFIPSTQTKWAYEYS
FT                   DQSWYLRFRLFITPEFKPKNGVSSGTTIAGKIASWYIGTNDQPWINFYIDNDSLKFFVD
FT                   EPTCATVALAQDQGNVSGNQVTLGNSYVSEVKNGLTREIPFSIRAEYCYASKITVKLKA
FT                   ANKPSDATLVGKTTGSASGVAVKVNSTYDNSKVLLKADGSNTVDYNFAAWSNNLLFLPF
FT                   TAQLVPDGSGNAVGVGTFSGNATFSFTYE"
     MQRKGNKLLI QLCSVILLFF TTSWYALANE CYIERNAEGD YHMKISSTQL SLASQMVEVP        60
     TEIAEATWDV NIQLRGDAIG CKSLGDSKAV HFLNTADPSL ISTYTTTNGA ALLKTTVPGI       120
     VYSVELLCLS CGAADELDLW LPAQSGADNF IPSTQTKWAY EYSDQSWYLR FRLFITPEFK       180
     PKNGVSSGTT IAGKIASWYI GTNDQPWINF YIDNDSLKFF VDEPTCATVA LAQDQGNVSG       240
     NQVTLGNSYV SEVKNGLTRE IPFSIRAEYC YASKITVKLK AANKPSDATL VGKTTGSASG       300
     VAVKVNSTYD NSKVLLKADG SNTVDYNFAA WSNNLLFLPF TAQLVPDGSG NAVGVGTFSG       360
     NATFSFTYE                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page