(data stored in ACNUC7421 zone)

EMBL: BA000007.YADD

BA000007.YADD        Location/Qualifiers
FT   CDS             151341..152237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="ECs_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33559"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33559"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X932"
FT                   /protein_id="BAB33559.1"
FT                   /translation="MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLH
FT                   LESGSFIEESLKGHSTDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHR
FT                   HLEADHDKLPLVVPILFYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPD
FT                   DEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYTSESQLVAMQNYMLQRGHTE
FT                   QADLFYGVLRDRETGGKSMMTLAQWFEEKGIEKGIQQGRQEERQEFAQRFLSKGMSRED
FT                   VAEMTNLSLAEIDRLIN"
     MDAPSTTPHD AVFKQFLMHA ETARDFLEIH LPVELRELCD LNTLHLESGS FIEESLKGHS        60
     TDVLYSVQMQ GNPGYLHVVI EHQSKPDKKM AFRMMRYSIA AMHRHLEADH DKLPLVVPIL       120
     FYQGEATPYP LSMCWFDMFY SPELARRVYN SPFPLVDITI TPDDEIMQHR RIAILELLQK       180
     HIRQRDLMLL LEQLVTLIDE GYTSESQLVA MQNYMLQRGH TEQADLFYGV LRDRETGGKS       240
     MMTLAQWFEE KGIEKGIQQG RQEERQEFAQ RFLSKGMSRE DVAEMTNLSL AEIDRLIN         298
//

If you have problems or comments...

PBIL Back to PBIL home page