(data stored in ACNUC7421 zone)

EMBL: BA000007.YADI

BA000007.YADI        Location/Qualifiers
FT   CDS             148950..149390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECs_0133"
FT                   /product="PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33556"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33556"
FT                   /db_xref="GOA:Q8X935"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X935"
FT                   /protein_id="BAB33556.1"
FT                   /translation="MLGWVITCHDDRAQEILDVLEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGAPEVSSIWHQQQKNPPFVLKHNLYEY"
     MLGWVITCHD DRAQEILDVL EKKHGALLQC RAVNFWRGLS SNMLSRMMCD ALHEADSGEG        60
     VIFLTDIAGA PPYRVASLLS HKHSRCEVIS GVTLPLIEQM MACRETMTSS EFRERIVELG       120
     APEVSSIWHQ QQKNPPFVLK HNLYEY                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page