(data stored in ACNUC7421 zone)

EMBL: BA000007.YADK

BA000007.YADK        Location/Qualifiers
FT   CDS             complement(155449..156039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="ECs_0140"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33563"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33563"
FT                   /db_xref="GOA:Q8X920"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X920"
FT                   /protein_id="BAB33563.1"
FT                   /translation="MLCRHHKIVHFLGLATALITPFAYSGQDVDLTAKIVPSTCQVEVS
FT                   NNGVVDLGTVTLDYFADNVTPTTDYAGGKTFNVNVVSCDNIQTTQSQMKLDFQPQAGSL
FT                   AQANNQIFSNEYEQQATGAKNVGIVIFSAQPNQQTFNVRGTDGSSTAIYSVAPGNAVPS
FT                   TWTFYSRMQRVNNALPPESGMVRSQVIVNVSYE"
     MLCRHHKIVH FLGLATALIT PFAYSGQDVD LTAKIVPSTC QVEVSNNGVV DLGTVTLDYF        60
     ADNVTPTTDY AGGKTFNVNV VSCDNIQTTQ SQMKLDFQPQ AGSLAQANNQ IFSNEYEQQA       120
     TGAKNVGIVI FSAQPNQQTF NVRGTDGSST AIYSVAPGNA VPSTWTFYSR MQRVNNALPP       180
     ESGMVRSQVI VNVSYE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page