(data stored in ACNUC7421 zone)

EMBL: BA000007.YADL

BA000007.YADL        Location/Qualifiers
FT   CDS             complement(156060..156665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="ECs_0141"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33564"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33564"
FT                   /db_xref="GOA:Q8X919"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X919"
FT                   /protein_id="BAB33564.1"
FT                   /translation="MKLKVIATLIATVAVGVSFNSNFASASTTSASLTVNSNLTMGTCS
FT                   AQIMDNSNKVINEVVFGNVYISELGAKSKVQQFKIRFSNCSGLPQNSAQIVLAPNGISC
FT                   AGSQSSSAGFSNKFTDASAATRTAVEVWTTDTPESNGSTQFHCAQKIPVPVTLPADTTT
FT                   QPYDYPLSARMTVAEGRLVTDVRPGNFRSPTTFTITYQ"
     MKLKVIATLI ATVAVGVSFN SNFASASTTS ASLTVNSNLT MGTCSAQIMD NSNKVINEVV        60
     FGNVYISELG AKSKVQQFKI RFSNCSGLPQ NSAQIVLAPN GISCAGSQSS SAGFSNKFTD       120
     ASAATRTAVE VWTTDTPESN GSTQFHCAQK IPVPVTLPAD TTTQPYDYPL SARMTVAEGR       180
     LVTDVRPGNF RSPTTFTITY Q                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page