(data stored in ACNUC7421 zone)

EMBL: BA000007.YADM

BA000007.YADM        Location/Qualifiers
FT   CDS             complement(156680..157228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="ECs_0142"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33565"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33565"
FT                   /db_xref="GOA:Q8X918"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X918"
FT                   /protein_id="BAB33565.2"
FT                   /translation="MKRILLTSALIGLGLPAVGSATDLNVDFTATVLATTCTITIVEDG
FT                   GPAVTGSNDEYSLTIPDVGLDKVATAAPEAQANFKLKASDCSNGYSKIFTTLTGTTVSG
FT                   KLIVNEATSGAAGVGMGIKRRDTADSTFFTPNNTDKFEWSADEKASGVPLTVALRETTA
FT                   GAGRTGAFQAKATFNFTYE"
     MKRILLTSAL IGLGLPAVGS ATDLNVDFTA TVLATTCTIT IVEDGGPAVT GSNDEYSLTI        60
     PDVGLDKVAT AAPEAQANFK LKASDCSNGY SKIFTTLTGT TVSGKLIVNE ATSGAAGVGM       120
     GIKRRDTADS TFFTPNNTDK FEWSADEKAS GVPLTVALRE TTAGAGRTGA FQAKATFNFT       180
     YE                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page