(data stored in ACNUC7421 zone)

EMBL: BA000007.YADN

BA000007.YADN        Location/Qualifiers
FT   CDS             complement(160696..161292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="ECs_0145"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33568"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33568"
FT                   /db_xref="GOA:A0A0H3JBS4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBS4"
FT                   /protein_id="BAB33568.1"
FT                   /translation="MKKALLAAALVMASGSALAVDGGHIDFNGMVQSGTCKVGVVDTGM
FT                   HSVTTDGVVTLDTANVTDTFAEVSATAVGLLPKEFMISVECDPGAPKNAELTMGSASYA
FT                   NTSGTLNNNMNITVNGIAPAQNVNIAVHNMKNKAGAAEIKQVHMNNSSEVQELTLDAEG
FT                   KGQYVFNASYVKAPNSPAVTAGHVTTNALYTVAYK"
     MKKALLAAAL VMASGSALAV DGGHIDFNGM VQSGTCKVGV VDTGMHSVTT DGVVTLDTAN        60
     VTDTFAEVSA TAVGLLPKEF MISVECDPGA PKNAELTMGS ASYANTSGTL NNNMNITVNG       120
     IAPAQNVNIA VHNMKNKAGA AEIKQVHMNN SSEVQELTLD AEGKGQYVFN ASYVKAPNSP       180
     AVTAGHVTTN ALYTVAYK                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page