(data stored in ACNUC7421 zone)

EMBL: BA000007.YADS

BA000007.YADS        Location/Qualifiers
FT   CDS             complement(181201..181824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="ECs_0161"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33584"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33584"
FT                   /db_xref="GOA:Q8X8Z1"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8Z1"
FT                   /protein_id="BAB33584.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRHLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
     MLVYWLDIVG TAVFAISGVL LAGKLRMDPF GVLVLGVVTA VGGGTIRDMA LDHGPVFWVK        60
     DPTDLVVAMV TSMLTIVLVR QPRHLPKWML PVLDAVGLAV FVGIGVNKAF NAEAGPLIAV       120
     CMGVITGVGG GIIRDVLARE IPMILRTEIY ATACIIGGIV HATAYYTFSV PLETASMMGM       180
     VVTLLIRLAA IRWHLKLPTF ALDENGR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page