(data stored in ACNUC7421 zone)

EMBL: BA000007.YAEH

BA000007.YAEH        Location/Qualifiers
FT   CDS             complement(187909..188295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="ECs_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33590"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33590"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62769"
FT                   /protein_id="BAB33590.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
     MYDNLKSLGI TNPEEIDRYS LRQEANNDIL KIYFQKDKGE FFAKSVKFKY PRQRKTVVAD        60
     GVGQGYKEVQ EISPNLRYII DELDQICQRD RSEVDLKRKI LDDLRHLESV VTNKISEIEA       120
     DLEKLTRK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page