(data stored in ACNUC7421 zone)

EMBL: BA000007.YAEQ

BA000007.YAEQ        Location/Qualifiers
FT   CDS             217636..218094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="ECs_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33615"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33615"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X8W6"
FT                   /protein_id="BAB33615.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCAQFANLSVWYLDDEQLAKVSAFADRTMTL"
     MALKATIYKA TVNVADLDRN QFLDASLTLA RHPSETQERM MLRLLAWLKY ADERLQFTRG        60
     LCADDEPEAW LRNDHLGIDL WIELGLPDER RIKKACTQAA EVALFTYNSR AAQIWWQQNQ       120
     SKCAQFANLS VWYLDDEQLA KVSAFADRTM TL                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page