(data stored in ACNUC7421 zone)

EMBL: BA000007.YAFD

BA000007.YAFD        Location/Qualifiers
FT   CDS             234473..235252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="ECs_0205"
FT                   /product="endo/exonuclease/phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33628"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33628"
FT                   /db_xref="GOA:P0A8U4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8U4"
FT                   /protein_id="BAB33628.2"
FT                   /translation="MRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIRILVWNIY
FT                   KQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLPQHPSGVM
FT                   TLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLGVDVYSKQ
FT                   LLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRRRAFGRPL
FT                   DFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
     MRYVAGQPAE RILPPGSFAS IGQALPPGEP LSTEERIRIL VWNIYKQQRA EWLSVLKNYG        60
     KDAHLVLLQE AQTTPELVQF ATANYLAADQ VPAFVLPQHP SGVMTLSAAH PVYCCPLRER       120
     EPILRLAKSA LVTVYPLPDT RLLMVVNIHA VNFSLGVDVY SKQLLPIGDQ IAHHSGPVIM       180
     AGDFNAWSRR RMNALYRFAR EMSLRQVRFT DDQRRRAFGR PLDFVFYRGL NVSEASVLVT       240
     RASDHNPLLV EFSPGKPDK                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page