(data stored in ACNUC7421 zone)

EMBL: BA000007.YAFJ

BA000007.YAFJ        Location/Qualifiers
FT   CDS             282295..283062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="ECs_0250"
FT                   /product="type 2 glutamine amidotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33673"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33673"
FT                   /db_xref="GOA:Q8X7R0"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R0"
FT                   /protein_id="BAB33673.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGKTDSEKAFCWLLYKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRQKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
     MCELLGMSAN VPTDICFSFT GLVQRGGGTG PHKDGWGITF YEGKGCRTFK DPQPSFNSPI        60
     AKLVQDYPIK SCSVVAHIRQ ANRGEVALEN THPFTRELWG RNWTYAHNGQ LTGYKSLETG       120
     NFRPVGKTDS EKAFCWLLYK LTQRYPRTPG NMAAVFKYIA SLADELRQKG VFNMLLSDGR       180
     YVMAYCSTNL HWITRRAPFG VATLLDQDVE IDFSSQTTPN DVVTVIATQP LTGNETWQKI       240
     MPGEWRLFCL GERVV                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page