(data stored in ACNUC7421 zone)

EMBL: BA000007.YAGU

BA000007.YAGU        Location/Qualifiers
FT   CDS             335400..336014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="ECs_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33740"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33740"
FT                   /db_xref="GOA:P0AAA2"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAA2"
FT                   /protein_id="BAB33740.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
     MNIFEQTPPN RRRYGLAAFI GLIAGVVSAF VKWGAEVPLP PRSPVDMFNA ACGPESLIRA        60
     AGQIDCSRNF LNPPYIFLRD WLGLTDPNAA VYTFAGHVFN WVGVTHIIFS IVFAVGYCVV       120
     AEVFPKIKLW QGLLAGALAQ LFVHMISFPL MGLTPPLFDL PWYENVSEIF GHLVWFWSIE       180
     IIRRDLRNRI THEPDPEIPL GSNR                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page