(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHC

BA000007.YAHC        Location/Qualifiers
FT   CDS             complement(386013..386315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="ECs_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33789"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33789"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B3"
FT                   /protein_id="BAB33789.1"
FT                   /translation="MVWAFFAALAAGWLASVSGLSAFWASVITTVPFSAVVVWQGRFWL
FT                   LSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRDGY"
     MVWAFFAALA AGWLASVSGL SAFWASVITT VPFSAVVVWQ GRFWLLSFIP GGFLGMTLFF        60
     ASGMNWTVTL LGFLAGNCVG IISEYGGQKL SEATTKRDGY                             100
//

If you have problems or comments...

PBIL Back to PBIL home page