(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHE

BA000007.YAHE        Location/Qualifiers
FT   CDS             387423..388286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="ECs_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33791"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33791"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6B1"
FT                   /protein_id="BAB33791.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   RLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVIDKQNIASA
FT                   VASMMGLGIGLTPSADDYLTGLALILFISGHPAGKYKEEFYLGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     MWALTADADF LAQRGQGQVE QVFARAVNIA LPARQQLLTL LCEEYDNAPN SCRLALTHFD        60
     DLFRHGDKVQ FDDQGITVGQ HLHIEMSRCR RWLSPTLQMT AVNFRLIAWQ QWHDIIHQHL       120
     GENETLFNYR GDNPFYQALN KELHIKRRAV IQAVIDKQNI ASAVASMMGL GIGLTPSADD       180
     YLTGLALILF ISGHPAGKYK EEFYLGLQRG RNNTTLLSAI TLEAALQQRC RENIHRFIHN       240
     IIYDIPGNAT QAIEKIKHIG SSSGCDMLYG MADGCALSQT YGGNYVS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page