(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHG

BA000007.YAHG        Location/Qualifiers
FT   CDS             389823..391241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="ECs_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33793"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33793"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A9"
FT                   /protein_id="BAB33793.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQFDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPILRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVAQQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAVDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
     MSQSLFSQPL NVINVGIAMF SDDLKKQHVE VTQFDWTPPG QGNMQVVQAL DNIADSPLAD        60
     KIAAANQQAL ERIIQSHPVL IGFDQAINVV PGMTPKTILH AGPPITWEKM CGAMKGAVTG       120
     ALVFEGLAKD LDEAAELAAS GEITFSPCHE HDCVGSMAGV TSASMFMHIV KNKTYGNIAY       180
     TNMSEQMAKI LRMGANDQSV IDRLNWMRDV QGPILRDAMK IIGEIDLRLM LAQALHMGDE       240
     CHNRNNAGTT LLIQALTPGI IQAGYSVAQQ REVFEFVASS DYFSGPTWMA MCKAAMDAAH       300
     GIEYSTVVTT MARNGVEFGL RVSGLPGQWF TGPAQQVIGP MFAGYKPEDS GLDIGDSAIT       360
     ETYGIGGFAM ATAPAIVALV GGTVEEAIDF SRQMREITLG ENPNVTIPLL GFMGVPSAVD       420
     ITRVGSSGIL PVINTAIAHK DAGVGMIGAG IVHPPFACFE KAILGWCERY GV               472
//

If you have problems or comments...

PBIL Back to PBIL home page