(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHI

BA000007.YAHI        Location/Qualifiers
FT   CDS             391756..392706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="ECs_0372"
FT                   /product="carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33795"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33795"
FT                   /db_xref="GOA:Q8X6A8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A8"
FT                   /protein_id="BAB33795.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSESQRDELQKANPDWRFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTDAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPEKQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
     MKELVVVAIG GNSIIKDNAS QSIEHQAEAV KAVADTVLEM LASDYDIVLT HGNGPQVGLD        60
     LRRAEIAHER EGLPLTPLAN CVADTQGGIG YLIQQALNNR LARHGEKKAV TVVTQVEVDK       120
     NDPGFAHPTK PIGAFFSESQ RDELQKANPD WRFVEDAGRG YRRVVASPEP KRIVEAPAIK       180
     ALIQQGFVVI GAGGGGIPVV RTDAGDYQSV DAVIDKDLST ALLAREIHAD ILVITTGVEK       240
     VCIHFGKPEK QALDRVDIAT MTRYMQEGHF PPGSMLPKII ASLTFLEQGG KEVIITTPEC       300
     LPAALRGETG THIIKT                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page