(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHJ

BA000007.YAHJ        Location/Qualifiers
FT   CDS             392716..394098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="ECs_0373"
FT                   /product="metallo-dependent hydrolase domain deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33796"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33796"
FT                   /db_xref="GOA:Q8X6A7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6A7"
FT                   /protein_id="BAB33796.1"
FT                   /translation="MKENNSRREFLSQSGKMVTAAALFGTSVPLAHAAVSGTTNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQNGKIVALRENKQHPDATLP
FT                   HYDAGDKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   SGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDELAHRMAAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
     MKENNSRREF LSQSGKMVTA AALFGTSVPL AHAAVSGTTN CEANNTMKIT DPHYYLDNVL        60
     LETGFDYENG VAVQTRTARQ TVEIQNGKIV ALRENKQHPD ATLPHYDAGD KLMLPTTRDM       120
     HIHLDKTFYG GPWRSLNRPA GTTIQDMIKL EQKMLPELQP YTQERAEKLI DLLQSKGTTI       180
     ARSHCNIEPV SGLKNLQNLQ AVLARRQAGF ECEIVAFPQH GLLLSKSEPL MREAMQAGAH       240
     YVGGLDPTSV DGAMEKSLDT MFQIALDYDK GVDIHLHETT PSGVAAINYM VETVEKTPQL       300
     KGKLTISHAF ALATLNEQQV DELAHRMAAQ QISIASTVPI GTLHMPLKQL HDKGVKVMTG       360
     TDSVIDHWSP YGLGDMLEKA NLYAQLYIRP NEQNLSRSLF LATGDVLPLN EKGERVWPKA       420
     QDDASFVLVD ASCSAEAVAR ISPRTATFHK GQLVWGSVAG                             460
//

If you have problems or comments...

PBIL Back to PBIL home page