(data stored in ACNUC7421 zone)

EMBL: BA000007.YAHO

BA000007.YAHO        Location/Qualifiers
FT   CDS             403184..403459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="ECs_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33806"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33806"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X699"
FT                   /protein_id="BAB33806.1"
FT                   /translation="MKIISKMLVGALAFAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTADIYKKK"
     MKIISKMLVG ALAFAVTNVY AAELMTKAEF EKVESQYEKI GDISTSNEMS TADAKEDLIK        60
     KADEKGADVL VLTSGQTDNK IHGTADIYKK K                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page