(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIA

BA000007.YAIA        Location/Qualifiers
FT   CDS             466759..466950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="ECs_0439"
FT                   /product="OxyR-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33862"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33862"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAN7"
FT                   /protein_id="BAB33862.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
     MPTKPPYPRE AYIVTIEKGK PGQTVTWYQL RADHPKPDSL ISEHPTAQEA MDAKKRYEDP        60
     DKE                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page