(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIL

BA000007.YAIL        Location/Qualifiers
FT   CDS             434971..435510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECs_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33832"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33832"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5J6"
FT                   /protein_id="BAB33832.2"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDNPYADFKVPDDLMW"
     MAKLTLQEQL LKAGLVTSKK AAKVERTAKK SRVQAREARA AVEENKKAQL ERDKQLSEQQ        60
     KQAALAKEYK AQVKQLIEMN RITIANGDIG FNFTDGNLIK KIFVDKLTQA QLINGRLAIA       120
     RLLVDNNSEG EYAIIPASVA DKIAQRDASS IVLHSALSAE EQDEDNPYAD FKVPDDLMW        179
//

If you have problems or comments...

PBIL Back to PBIL home page