(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIT

BA000007.YAIT        Location/Qualifiers
FT   CDS             451256..454198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiT"
FT                   /locus_tag="ECs_0424"
FT                   /product="flagellin structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33847"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33847"
FT                   /db_xref="GOA:A0A0H3JCC1"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCC1"
FT                   /protein_id="BAB33847.1"
FT                   /translation="MHSWKKKLIVSQLALACTLAITSQANAATNDISGQTYNTFHHYND
FT                   ATYADDVYYDGYVGWNNYAADSYYNGDIYPVINNATVNGVISTYYLDDGISTNTNANSL
FT                   TIKNSTIHGMITSECMTTDCADDRATGYVYDRLTLSVDNSTIDDNYEHYTYNGTYNNAA
FT                   DTHVVDVYDMGTAITLDQEVDLSITNNSHVAGITLTQGYEWEDIDDNTVSTGVNSSEVF
FT                   NNTITVKDSTVTSGSWTDEGTTGWFGHTGNASNYSNTLTADDVAIAAIANPYADNAMQT
FT                   TVTLDNSTLMGDVVFSSNFDENFFPQGANSYRDADGDVDTNGWDGTDRMDVTLNNGSKW
FT                   VGAAMSVHMVDEDGDGSYDGYAVGTEATATLLDIAANSLWPSSTVGVDNINTQYDENGH
FT                   IVGNEVYQSGLFNVTLNGGSEWDTTKSSLIDTLSINSGSQVNVADSRLISDTVSLTGGS
FT                   NLNIGEDGHVATNTLTIDNSTVKMSDDVSAGWGLEDAALYANTITVTNDGLLDINVDQF
FT                   DANPFQADTLNLTSTTDTNGNIHAGVFDIHSSDYVMDTDLVNDRTNDTTKSNYGYGLIA
FT                   MNSDGHLTINGNGDNDNTASIEAGQNEVDNNGDHVAAATGNYKVRIDNATGAGSIADYN
FT                   GNELIYVNDKNSNATFSAANKADLGAYTYQAEQRGNTVVLQQMELTDYANMALSIPSAN
FT                   TNIWNLEQDTVGTRLTNSRHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDT
FT                   KIDGNNAKWIVGAAAGFAKGDMNDRSGQVDQDSQTAYIYSSAHFANNVFVDGSLSYSHF
FT                   NNDLSATMSNGTYVDGSTNSDAWGFGLKAGYDFKLGDAGYVTPYGSISGLFQSGDDYQL
FT                   SNDMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDNDVNGDSID
FT                   NGTEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
     MHSWKKKLIV SQLALACTLA ITSQANAATN DISGQTYNTF HHYNDATYAD DVYYDGYVGW        60
     NNYAADSYYN GDIYPVINNA TVNGVISTYY LDDGISTNTN ANSLTIKNST IHGMITSECM       120
     TTDCADDRAT GYVYDRLTLS VDNSTIDDNY EHYTYNGTYN NAADTHVVDV YDMGTAITLD       180
     QEVDLSITNN SHVAGITLTQ GYEWEDIDDN TVSTGVNSSE VFNNTITVKD STVTSGSWTD       240
     EGTTGWFGHT GNASNYSNTL TADDVAIAAI ANPYADNAMQ TTVTLDNSTL MGDVVFSSNF       300
     DENFFPQGAN SYRDADGDVD TNGWDGTDRM DVTLNNGSKW VGAAMSVHMV DEDGDGSYDG       360
     YAVGTEATAT LLDIAANSLW PSSTVGVDNI NTQYDENGHI VGNEVYQSGL FNVTLNGGSE       420
     WDTTKSSLID TLSINSGSQV NVADSRLISD TVSLTGGSNL NIGEDGHVAT NTLTIDNSTV       480
     KMSDDVSAGW GLEDAALYAN TITVTNDGLL DINVDQFDAN PFQADTLNLT STTDTNGNIH       540
     AGVFDIHSSD YVMDTDLVND RTNDTTKSNY GYGLIAMNSD GHLTINGNGD NDNTASIEAG       600
     QNEVDNNGDH VAAATGNYKV RIDNATGAGS IADYNGNELI YVNDKNSNAT FSAANKADLG       660
     AYTYQAEQRG NTVVLQQMEL TDYANMALSI PSANTNIWNL EQDTVGTRLT NSRHGLADNG       720
     GAWVSYFGGN FNGDNGTINY DQDVNGIMVG VDTKIDGNNA KWIVGAAAGF AKGDMNDRSG       780
     QVDQDSQTAY IYSSAHFANN VFVDGSLSYS HFNNDLSATM SNGTYVDGST NSDAWGFGLK       840
     AGYDFKLGDA GYVTPYGSIS GLFQSGDDYQ LSNDMKVDGQ SYDSMRYELG VDAGYTFTYS       900
     EDQALTPYFK LAYVYDDSNN DNDVNGDSID NGTEGSAVRV GLGTQFSFTK NFSAYTDANY       960
     LGGGDVDQDW SANVGVKYTW                                                   980
//

If you have problems or comments...

PBIL Back to PBIL home page