(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIW

BA000007.YAIW        Location/Qualifiers
FT   CDS             457652..458746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="ECs_0428"
FT                   /product="microcin Bac7 uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33851"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33851"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X5H6"
FT                   /protein_id="BAB33851.1"
FT                   /translation="MSRVNHLSSLSFLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSGIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAAKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
     MSRVNHLSSL SFLAVLVLAG CSSQAPQPLK KGEKAIDVAS VVRQKMPASV KDRDAWAKDL        60
     ATTFESQGLA PTLENVCSVL AVAQQESNYQ ADPAVPGLSK IAWQEIDRRA ERMHIPAFLV       120
     HTALKIKSPN GKSYSERLDS VRTEKQLSGI FDDLISMVPM GQTLFGSLNP VRTGGPMQVS       180
     IAFAEQHTKG YPWKMDGTVR QEVFSRRGGL WFGTYHLLNY PASYSAPIYR FADFNAGWYA       240
     SRNAAFQNAV SKASGVKLAL DGDLIRYDSK EPGKTELATR KLAAKLGMSD SEIRRQLEKG       300
     DSFSFEETAL YKKVYQLAEA KTGKSLPREM LPGIQLESPK ITRNLTTAWF AKRVDERRAR       360
     CMKQ                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page