(data stored in ACNUC7421 zone)

EMBL: BA000007.YAIY

BA000007.YAIY        Location/Qualifiers
FT   CDS             complement(458805..459113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="ECs_0429"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33852"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33852"
FT                   /db_xref="GOA:P0AAP9"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAP9"
FT                   /protein_id="BAB33852.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
     MADFTLSKSL FSGKYRNASS TPGNIAYALF VLFCFWAGAQ LLNLLVHAPG VYERLMQVQE        60
     TGRPRVEIGL GVGTIFGLIP FLVGCLIFAV VALWLHWRHR RQ                          102
//

If you have problems or comments...

PBIL Back to PBIL home page