(data stored in ACNUC7421 zone)

EMBL: BA000007.YAJD

BA000007.YAJD        Location/Qualifiers
FT   CDS             494861..495208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="ECs_0463"
FT                   /product="HNH nuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33886"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33886"
FT                   /db_xref="GOA:P0AAQ4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAQ4"
FT                   /protein_id="BAB33886.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     MAIIPKNYAR LESGYREKAL KIYPWVCGRC SREFVYSNLR ELTVHHIDHD HTNNPEDGSN        60
     WELLCLYCHD HEHSKYTEAD QYGTTVIAGE DAQKDVGEAK YNPFADLKAM MNKKK            115
//

If you have problems or comments...

PBIL Back to PBIL home page