(data stored in ACNUC7421 zone)

EMBL: BA000007.YAJQ

BA000007.YAJQ        Location/Qualifiers
FT   CDS             510737..511228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="ECs_0480"
FT                   /product="nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33903"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33903"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8E9"
FT                   /protein_id="BAB33903.2"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
     MPSFDIVSEV DLQEARNAVD NASREVESRF DFRNVEASFE LNDASKTIKV LSESDFQVNQ        60
     LLDILRAKLL KRGIEGSSLD VPENIVHSGK TWFVEAKLKQ GIESATQKKI VKMIKDSKLK       120
     VQAQIQGDEI RVTGKSRDDL QAVMAMVRGG DLGQPFQFKN FRD                         163
//

If you have problems or comments...

PBIL Back to PBIL home page