(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAA

BA000007.YBAA        Location/Qualifiers
FT   CDS             542738..543091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECs_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33932"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33932"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAQ8"
FT                   /protein_id="BAB33932.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
     MKYVDGFVVA VPADKKDAYR EMAAKAAPLF KEFGALRIVE CWASDVPDGK VTDFRMAVKA        60
     EENEEVVFSW IEYPSKEVRD AANQKMMSDP RMKEFGESMP FDGKRMIYGG FESIIDE          117
//

If you have problems or comments...

PBIL Back to PBIL home page