(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAB

BA000007.YBAB        Location/Qualifiers
FT   CDS             559972..560301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="ECs_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33947"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33947"
FT                   /db_xref="GOA:P0A8B7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8B7"
FT                   /protein_id="BAB33947.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
     MFGKGGLGNL MKQAQQMQEK MQKMQEEIAQ LEVTGESGAG LVKVTINGAH NCRRVEIDPS        60
     LLEDDKEMLE DLVAAAFNDA ARRIEETQKE KMASVSSGMQ LPPGFKMPF                   109
//

If you have problems or comments...

PBIL Back to PBIL home page