(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAE

BA000007.YBAE        Location/Qualifiers
FT   CDS             complement(531677..533377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="ECs_0499"
FT                   /product="ABC transporter periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33922"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33922"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE51"
FT                   /protein_id="BAB33922.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTLLR
FT                   QAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEKALETGKQQDVLELAQLAPGEL
FT                   RTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQ
FT                   RPIGDLAHHWETSADGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFIS
FT                   VKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRL
FT                   ESHDYYHLRHPLLKAVEYWITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVSSGISL
FT                   GFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIPHWQVP
FT                   DEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLLAHADLM
FT                   MGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQVMPDEENRFNALKAV
FT                   FSQLMTDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
     MRLLNRLNQY QRLWQPSAGK PQTVTVSELA ERCFCSERHV RTLLRQAQEA GWLEWQAQSG        60
     RGKRGQLRFL VTPESLRNAM MEKALETGKQ QDVLELAQLA PGELRTLLQP FMGGQWQNDT       120
     PTLRIPYYRP LEPLQPGFLP GRAEQHLAGQ IFSGLTRFDN NTQRPIGDLA HHWETSADGL       180
     RWDFYLRSTL HWHNGDAVKA SHLHQRLLML LQLPALDQLF ISVKRIEVTH PQCLTFFLHR       240
     PDYWLAHRLA SYCSHLAHPQ FPLIGTGPFR LTQFTAELVR LESHDYYHLR HPLLKAVEYW       300
     ITPPLFEKDL GTSCRHPVQI TIGKPEELQR VSQVSSGISL GFCYLTLRKS PRLSLWQARK       360
     VISIIHQSGL LQTLEVGENL ITASHALLPG WTIPHWQVPD EVKLPKTLTL VYHLPIELHT       420
     MAERLQATLA AEGCELTIIF HNAKNWDDTT LLAHADLMMG DRLIGEAPEY TLEQWLRCDP       480
     LWPHVFDAPA YAHLQSTLDA VQVMPDEENR FNALKAVFSQ LMTDATLTPL FNYHYRISAP       540
     PGVNGVRLTP RGWFEFTEAW LPAPSQ                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page