(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAP

BA000007.YBAP        Location/Qualifiers
FT   CDS             complement(573077..573871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="ECs_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33958"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33958"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD26"
FT                   /protein_id="BAB33958.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDISLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQKLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
     MDLLYRVKTL WAALRGNHYT WPAIDISLPG NRHFHLIGSI HMGSHDMAPL PTRLLKKLKN        60
     ADALIVEADV STSDTPFANL PACEALEERI SEEQLQKLQH ISQEMGISPS LFSTQPLWQI       120
     AMVLQATQAQ KLGLRAEYGI DYQLLQAAKQ QHKPVIELEG AENQIAMLLQ LPDKGLALLD       180
     DTLTHWHTNA RLLQQMMSWW LNAPPQNNEI TLPNTFSQSL YDVLMHQRNL AWRDKLRAMP       240
     PGRYVVAVGA LHLYGEGNLP QMLR                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page