(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAT

BA000007.YBAT        Location/Qualifiers
FT   CDS             578266..579558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="ECs_0539"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33962"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33962"
FT                   /db_xref="GOA:Q8XD21"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD21"
FT                   /protein_id="BAB33962.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWVAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   QVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASAINANLFAVFNIMDNMGSERELPKRMNKSLWRQSTWGNIIVVVLIMLMT
FT                   AALNLGSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGAILLSLIVAMVMKRNKTV"
     MMNTEGNNGN KPLGLWNVVS IGIGAMVGAG IFALLGQAAL LMEASTWVAF AFGGIVAMFS        60
     GYAYARLGAS YPSNGGIIDF FRRGLGNGVF SLALSLLYLL TLAVSIAMVA RAFGAYAVQF       120
     LHEGSQEEHL ILLYALGIIA VMTLFNSLSN HAVGRLEVIL VGIKMMILLL LIIAGVWSLQ       180
     PAHISVSAPP SSGAFFSCIG ITFLAYAGFG MMANAADKVK DPQVIMPRAF LVAIGVTTLL       240
     YISLALVLLS DVSALELEKY ADTAVAQAAS PLLGHVGYVI VVIGALLATA SAINANLFAV       300
     FNIMDNMGSE RELPKRMNKS LWRQSTWGNI IVVVLIMLMT AALNLGSLAS VASATFLICY       360
     LAVFVVAIRL RHDIHASLPI LIVGTLVMLL VIVGFIYSLW SQGSRALIWI IGAILLSLIV       420
     AMVMKRNKTV                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page