(data stored in ACNUC7421 zone)

EMBL: BA000007.YBAV

BA000007.YBAV        Location/Qualifiers
FT   CDS             529990..530361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECs_0496"
FT                   /product="competence-suppressing periplasmic
FT                   helix-hairpin-helix DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33919"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33919"
FT                   /db_xref="GOA:Q8XE54"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XE54"
FT                   /protein_id="BAB33919.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   NKAAVPAKASDEEGSRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     MKHGIKALLI TLSLACAGMS HSALAAASVA KPTAVETKAE APAAQNKAAV PAKASDEEGS        60
     RVSINNASAE ELARAMNGVG LKKAQAIVSY REEYGPFKTV EDLKQVPGMG NSLVERNLAV       120
     LTL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page