(data stored in ACNUC7421 zone)

EMBL: BA000007.YBBD

BA000007.YBBD        Location/Qualifiers
FT   CDS             621235..621495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbD"
FT                   /locus_tag="ECs_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33984"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33984"
FT                   /db_xref="GOA:Q8XCZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCZ4"
FT                   /protein_id="BAB33984.1"
FT                   /translation="MLAISSNLSKMIIFIIAIIIIVVLCVITYLYLYKDESLVSKHYIN
FT                   YMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDYFFLIFP"
     MLAISSNLSK MIIFIIAIII IVVLCVITYL YLYKDESLVS KHYINYMAIP ENDGVFTWLP        60
     DFFPHVAVDI SIYTNVEDDY FFLIFP                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page