(data stored in ACNUC7421 zone)

EMBL: BA000007.YBBJ

BA000007.YBBJ        Location/Qualifiers
FT   CDS             complement(608199..608657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECs_0551"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33974"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33974"
FT                   /db_xref="GOA:Q8XD05"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD05"
FT                   /protein_id="BAB33974.2"
FT                   /translation="MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLV
FT                   VWLVPLGWEWQGVMFAVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLE
FT                   SPLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLIIRAVIA"
     MMELIVVHPH IFWLSLGGLL LAAEMLGGNG YLLWSGVAAV ITGLVVWLVP LGWEWQGVMF        60
     AVLTLLAAWL WWKWLSRRVR EQKHSDSHLN QRGQQLIGRR FVLESPLVNG RGHMRVGDSS       120
     WPVSASEDLG AGTHVEVIAI EGITLIIRAV IA                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page