(data stored in ACNUC7421 zone)

EMBL: BA000007.YBCF

BA000007.YBCF        Location/Qualifiers
FT   CDS             642948..643841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECs_0583"
FT                   /product="carbonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34006"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34006"
FT                   /db_xref="GOA:Q8XCV5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8XCV5"
FT                   /protein_id="BAB34006.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   RTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTDDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGMPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
     MKTLVVALGG NALLQRGEAL TAENQYRNIA SAVPALARLA RSYRLAIVHG NGPQVGLLAL        60
     QNLAWKEVEP YPLDVLVAES QGMIGYMLAQ SLSAQPQMPP VTTVRTRIEV SPDDPAFLQP       120
     EKFIGPVYQP EEQEALEAAY GWQMKRDGKY LRRVVASPQP RKILDSEAIE LLLKEGHVVI       180
     CSGGGGVPVT DDGAGSEAVI DKDLAAALLA EQINADGLVI LTDADAVYEN WGMPQQRAIR       240
     HATPDELAPF AKADGSMGPK VTAVSGYVRS RGKPAWIGAL SRIEETLAGE AGTCISL          297
//

If you have problems or comments...

PBIL Back to PBIL home page