(data stored in ACNUC7421 zone)

EMBL: BA000007.YBCH

BA000007.YBCH        Location/Qualifiers
FT   CDS             complement(658249..659139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="ECs_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34022"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34022"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X566"
FT                   /protein_id="BAB34022.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRALLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAVPGVTPDGWYFSAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEHVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSSAPASGIVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPVAHGILEY"
     MRKFIFVLLT LLLVSPFSFA MKGIIWQPQN RDSQVTDTQW QGLMSQLRLQ GFDTLVLQWT        60
     RYGDAFTQPE QRALLFKRAA AAQQAGLKLI VGLNADPEFF MHQKQSSAAL ESYLNRLLAA       120
     DLQQARLWSA VPGVTPDGWY FSAEIDDLNW RSEAARQPLL TWLNNAQRLI SDVSAKPVYI       180
     SSFFAGNMSP DGYRQLLEHV KATGVNVWVQ DGSGVDKLTA EQRERYLQAS ADCQSSAPAS       240
     GIVYELFVAG KGKTFTAKPK PDAEIASLLA KRSSCGKDTL YFSLRYLPVA HGILEY           296
//

If you have problems or comments...

PBIL Back to PBIL home page