(data stored in ACNUC7421 zone)

EMBL: BA000007.YBCI

BA000007.YBCI        Location/Qualifiers
FT   CDS             complement(648485..649006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="ECs_0589"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34012"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34012"
FT                   /db_xref="GOA:Q8XCT8"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCT8"
FT                   /protein_id="BAB34012.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   NFGVAYGNVFGHRGFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTAYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
     MPTVITHAAV PLCIGLGLGS KVIPPRLLFA GIILAMLPDA DVLSFNFGVA YGNVFGHRGF        60
     THSLVFAFVV PLLCVLIGRR WFRAGLIRCW LFLTVSLLSH SLLDSVTTGG KGVGWLWPWS       120
     DERFFAPWQV IKVAPFALSR YTTAYGHQVI ISELMWVWLP GMLLMGMLWW RRR              173
//

If you have problems or comments...

PBIL Back to PBIL home page