(data stored in ACNUC7421 zone)

EMBL: BA000007.YBDJ

BA000007.YBDJ        Location/Qualifiers
FT   CDS             complement(688468..688716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="ECs_0618"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34041"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34041"
FT                   /db_xref="GOA:Q8XBX2"
FT                   /db_xref="InterPro:IPR010590"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBX2"
FT                   /protein_id="BAB34041.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLTLAQKLVTTFHLM
FT                   DLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFSLAD"
     MKHPLETLTT AAGILLMAFL SCLLLPAPAL GLTLAQKLVT TFHLMDLSQL YTLLFCLWFL        60
     VLGAIEYFVL RFIWRRWFSL AD                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page