(data stored in ACNUC7421 zone)

EMBL: BA000007.YBDM

BA000007.YBDM        Location/Qualifiers
FT   CDS             complement(716217..716846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="ECs_0640"
FT                   /product="chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34063"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34063"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBU4"
FT                   /protein_id="BAB34063.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRINAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNSQLMPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
     MGDTMQQRLT QDLTQFLASL PEDDRINAIN EIRMAIHQVS PFREEPVDCV LWVKNSQLMP        60
     NDYNPNNVAP PEKKLLKKSI EIDGFTQPIV VTHTDKNALE IVDGFHRHEI GKGSSSLKLR       120
     LKGYLPVTCL EGTRNQRIAA TIRHNRARGR HQITAMSEIV RELSQLGWDD NKIGKELGMD       180
     SDEVLRLKQI NGLQELFADR QYSRAWTVK                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page