(data stored in ACNUC7421 zone)

EMBL: BA000007.YBED

BA000007.YBED        Location/Qualifiers
FT   CDS             complement(743737..744000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeD"
FT                   /locus_tag="ECs_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34092"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34092"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A8J6"
FT                   /protein_id="BAB34092.1"
FT                   /translation="MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYTP
FT                   TVKPSSKGNYHSVSITINATHIEQVETLYEELGKIDIVRMVL"
     MKTKLNELLE FPTPFTYKVM GQALPELVDQ VVEVVQRHAP GDYTPTVKPS SKGNYHSVSI        60
     TINATHIEQV ETLYEELGKI DIVRMVL                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page