(data stored in ACNUC7421 zone)

EMBL: BA000007.YBEL

BA000007.YBEL        Location/Qualifiers
FT   CDS             756378..756860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="ECs_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34104"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34104"
FT                   /db_xref="InterPro:IPR009912"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAU1"
FT                   /protein_id="BAB34104.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
     MNKVAQYYRE LVASLSERLR NGERDIDALV EQARERVIKT GELTRTEVDE LTRAVRRDLE        60
     EFAMSYEESL KEESDSVFMR VIKESLWQEL ADITDKTQLE WREVFQDLNH HGVYHSGEVV       120
     GLGNLVCEKC HFHLPIYTPE VLTLCPKCGH DQFQRRPFEP                             160
//

If you have problems or comments...

PBIL Back to PBIL home page