(data stored in ACNUC7421 zone)

EMBL: BA000007.YBER

BA000007.YBER        Location/Qualifiers
FT   CDS             758072..758779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECs_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34106"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34106"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X522"
FT                   /protein_id="BAB34106.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTRFFDLSSSW
FT                   GIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFA
FT                   GYTFGRQYWQSPEDDNLPLLREFLARKEYDDSGNDMFYQLFASDDAYYATLPWQPLADY
FT                   PTCPETLKDMSDL"
     MDMESQKILF ALSTPMEIRN ECCLPSHSSP KMYLGTRFFD LSSSWGIDDR DDLLRTIHRM        60
     IDNGHAARLA GFYHRWFRYS PCEWRDYLAE LNEQGQAYAQ FVASTAECCG EGGIKAWDYV       120
     RMGFLSRMGV LNNWLSEEES LWIQSRIHLR ALRYYSNWRQ YFAGYTFGRQ YWQSPEDDNL       180
     PLLREFLARK EYDDSGNDMF YQLFASDDAY YATLPWQPLA DYPTCPETLK DMSDL            235
//

If you have problems or comments...

PBIL Back to PBIL home page