(data stored in ACNUC7421 zone)

EMBL: BA000007.YBET

BA000007.YBET        Location/Qualifiers
FT   CDS             complement(760213..760767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeT"
FT                   /locus_tag="ECs_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34108"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34108"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBM0"
FT                   /protein_id="BAB34108.1"
FT                   /translation="MNKKLMYIFTIFIVAAITCISQPKKTTLRDKAMVNYAFDYLSSPG
FT                   SLPFTTAATELSAIHGHSTSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQENPRAQS
FT                   KLGWIYLKGLGVKPDTRKAILWYKEAAEQGYAHAQYTLGLIYRNGSGINVNHYESQKWL
FT                   KLAAKQHYKNAERLLAGLPAH"
     MNKKLMYIFT IFIVAAITCI SQPKKTTLRD KAMVNYAFDY LSSPGSLPFT TAATELSAIH        60
     GHSTSQYRLG EFYLHGSDGK PLDYTQARYW YEQSAEQENP RAQSKLGWIY LKGLGVKPDT       120
     RKAILWYKEA AEQGYAHAQY TLGLIYRNGS GINVNHYESQ KWLKLAAKQH YKNAERLLAG       180
     LPAH                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page