(data stored in ACNUC7421 zone)

EMBL: BA000007.YBEU

BA000007.YBEU        Location/Qualifiers
FT   CDS             760869..761576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeU"
FT                   /locus_tag="ECs_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34109"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34109"
FT                   /db_xref="InterPro:IPR009677"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X521"
FT                   /protein_id="BAB34109.1"
FT                   /translation="MNKEEQYLLFALSAPMEILNQGCKPAHDSPKMYTGIKEFDLSSSW
FT                   GINNRDDLIQTIYQMTDDGHANDLAGLYLTWHRSSPEEWKALIAGGSERGLIYTQFVAQ
FT                   TAMCCGEGGIKAWDYVRMGFLSRVGVLNKWLTEDESLWLQSRVYERAHHYYHSWMHYFS
FT                   AYSLGRLYWQSSQCEDNASLREALTLYKYDSAGSRMFEELAAGSDRFYATLPWQPLTVQ
FT                   PECPVTLKDVSDL"
     MNKEEQYLLF ALSAPMEILN QGCKPAHDSP KMYTGIKEFD LSSSWGINNR DDLIQTIYQM        60
     TDDGHANDLA GLYLTWHRSS PEEWKALIAG GSERGLIYTQ FVAQTAMCCG EGGIKAWDYV       120
     RMGFLSRVGV LNKWLTEDES LWLQSRVYER AHHYYHSWMH YFSAYSLGRL YWQSSQCEDN       180
     ASLREALTLY KYDSAGSRMF EELAAGSDRF YATLPWQPLT VQPECPVTLK DVSDL            235
//

If you have problems or comments...

PBIL Back to PBIL home page