(data stored in ACNUC7421 zone)

EMBL: BA000007.YBFE

BA000007.YBFE        Location/Qualifiers
FT   CDS             complement(791630..791992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="ECs_0716"
FT                   /product="LexA-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34139"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34139"
FT                   /db_xref="GOA:P0AAU8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAU8"
FT                   /protein_id="BAB34139.1"
FT                   /translation="MYYGALSIRAEAWLIVSPEVTKIMAKEQTDRTTLDLFAHERRPGR
FT                   PKTNPLSRDEQLRINKRNQLKRDKVRGLKRVELKLNAEAVEALNELAESRNMSRSELIE
FT                   EMLMQQLAALRSQGIV"
     MYYGALSIRA EAWLIVSPEV TKIMAKEQTD RTTLDLFAHE RRPGRPKTNP LSRDEQLRIN        60
     KRNQLKRDKV RGLKRVELKL NAEAVEALNE LAESRNMSRS ELIEEMLMQQ LAALRSQGIV       120
//

If you have problems or comments...

PBIL Back to PBIL home page