(data stored in ACNUC7421 zone)

EMBL: BA000007.YDBD

BA000007.YDBD        Location/Qualifiers
FT   CDS             468385..470664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /locus_tag="ECs_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33865"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33865"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XEA4"
FT                   /protein_id="BAB33865.2"
FT                   /translation="MNRINILVICMVLFFMTGNACATEWISSEDLITSDFHLMTADERN
FT                   VVKAATDDSMEAAYMLKDNIRWYYHNGDLSLPANFSNKNKLVVNGNLTISGDYDDYLSG
FT                   NGHLIVLGNVIVDNFINHDFAYVKGQMTAKGLVYADYNDHNFEVMKGISARGIIVSDKA
FT                   TQFEVIKAEFYINEDGSGEGYNWDENIQKAYSLVTADLYDHTEIETDNISNAYPDYDSV
FT                   ADNIVQGLPLFRDKAAPEINEKLKWIETGKLDNFPANKIKHQDPLVARFLTHTESLSPA
FT                   VMLQLLQHPDDQTRESMAQSWPAQQMHWLTDELIKDEAVARGLVKNSNISADVNKKLMS
FT                   VPVESVQLEQARQDNLSPDIVASLSHSPFLSVRKTLLSHYDYAWLVPTAVADELINNED
FT                   PELRERITGADLTAQQAVMLSKDKSLKVREALARTLTELKITQLSATLRTEDIERIAEQ
FT                   MYLDNKENKNIVKVLLIALPEMCQLSLAKEDVHNLREGARYLTSKDVISYLLTQHDVPT
FT                   VWDELARDKLLPLEYKKQLWQRTLNLMMSKRQEDQEQAYEVQLALIDNGVVDEEMLNNA
FT                   IDLLVDLPAEYRYRMRNQLFDNKELPSGIINKLDQQYRFNSDWALAVVSMKNSTRRQSE
FT                   RGLHRWNHEDSDIFAELATIKDKSDDEWWRALLQSRNDHLRQTALRNAHTPASLLTTLT
FT                   ESQDRSLAINNPQLAADVKTVWLKEDPSLLLFVDKPDLSQLRDLVKTGATRKIRNEARH
FT                   RLEEKQ"
     MNRINILVIC MVLFFMTGNA CATEWISSED LITSDFHLMT ADERNVVKAA TDDSMEAAYM        60
     LKDNIRWYYH NGDLSLPANF SNKNKLVVNG NLTISGDYDD YLSGNGHLIV LGNVIVDNFI       120
     NHDFAYVKGQ MTAKGLVYAD YNDHNFEVMK GISARGIIVS DKATQFEVIK AEFYINEDGS       180
     GEGYNWDENI QKAYSLVTAD LYDHTEIETD NISNAYPDYD SVADNIVQGL PLFRDKAAPE       240
     INEKLKWIET GKLDNFPANK IKHQDPLVAR FLTHTESLSP AVMLQLLQHP DDQTRESMAQ       300
     SWPAQQMHWL TDELIKDEAV ARGLVKNSNI SADVNKKLMS VPVESVQLEQ ARQDNLSPDI       360
     VASLSHSPFL SVRKTLLSHY DYAWLVPTAV ADELINNEDP ELRERITGAD LTAQQAVMLS       420
     KDKSLKVREA LARTLTELKI TQLSATLRTE DIERIAEQMY LDNKENKNIV KVLLIALPEM       480
     CQLSLAKEDV HNLREGARYL TSKDVISYLL TQHDVPTVWD ELARDKLLPL EYKKQLWQRT       540
     LNLMMSKRQE DQEQAYEVQL ALIDNGVVDE EMLNNAIDLL VDLPAEYRYR MRNQLFDNKE       600
     LPSGIINKLD QQYRFNSDWA LAVVSMKNST RRQSERGLHR WNHEDSDIFA ELATIKDKSD       660
     DEWWRALLQS RNDHLRQTAL RNAHTPASLL TTLTESQDRS LAINNPQLAA DVKTVWLKED       720
     PSLLLFVDKP DLSQLRDLVK TGATRKIRNE ARHRLEEKQ                              759
//

If you have problems or comments...

PBIL Back to PBIL home page